.

Rekombinant Oryza sativa subsp. indica Katyon taşıyıcısı HKT8 (HKT8) (Rekombinant Protein)

Rekombinant Oryza sativa subsp. indica Katyon taşıyıcısı HKT8 (HKT8) (Rekombinant Protein)

₺ 289.20

İşlenmemiş
Depoda

Genel ad : HKT8; HKT1. 5, SKC1; Os I_001542; HKT1.5; SKC1; Os HKT8. Syn Name : Rekombinant Katyon taşıyıcı HKT8( HKT8); Katyon taşıyıcı HKT8; Os HKT8;HKT1; 5. HKT1; 5. Kaynak : E Coli veya Maya.Saflık : > %90; * Etiket Bilgisi : Etiketlendi; * Türler : Oryza sativa subsp.ındica (Pirinç).Depolama Tamponu : PBS p H 7.4, %50 gliserol; * Seq Pos : 1-554. Depolama : -20 derece C'de saklayın. Genişletilmiş depolama için -20 veya -80 derece C'de saklayın.Bu öğe için ÜCRETSİZ-8 GB-USBDrive.Madde araştırma kullanım içindir.Teşhis / tedavi prosedürü için değil. * Form : Bu ürün özel üretim gerektirir ve teslim süresi 5-9 hafta arasındadır.Spesifikasyonlarınıza göre özel üretim yapabiliriz.; *Seq : MSSLDATTPRYDEFKRİYHLFLFHAHPFWLQLLYFLFİSLLGFLMLKALPMKTSMVPRPMDLDLİFTSVSATTVSSMVAVEMESFSNSQLLLİTLLMLLGGEVFTSİLGLYFTNAKYSSKMİATLPDDDDHGGSGKPPPATTSPSSTLVELELAPPMDVVVVNPTTTATTHDEVELGLGRRNKRGCTCTTTHTSSSSSASKTTTTRLLMFVVMGYHAVVHVAGYTAİVVYLSAVGGAGAVVAGKGİSAHTFAİFTVVSTFANCGFVPTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFLRLAİAALERVTGWPELGELLİRRRRGGGEGYHHLLPSSRTRFLALTVAVLVVAQLALFCAMEWGSDGLRGLTAGQKLVGALFMAVNSRHSGEMVLDLSTVSSAVVVLYVVMMYLPPYTTFVPVQDKHQQTGAQSGQEGSSSSSİWQKLLMSPLSCLAİFİVVİCİTERRQİADDPİNYSVLNİVVEVİSAYGNVGFSTGYSCARQVRPDGSCRDLWVGFSGKWSKQGKLTLMAVMFYGRLKKFSLHGGQAWKİE; *Üyelik# : A2 WNZ9; *Uniprot Özeti : Fonksiyon : Na vuruyor vuruyor kökleri arasında sodyum sirkülasyon tarafından dengesinin+ K+/düzenleyen sodyum bir taşıyıcı olarak hareket gibi Görünüyor.Indica Nona Bokra ve Pokkali çeşitlerinde tuz toleransına katkıda bulunuyor gibi görünüyor.İlan.1 ALT hücre yeri : Membran; Çok geçişli membran proteini Muhtemel Ref.1. Doku özgüllüğü : Esas olarak düğümlerin, internodların, yaprak kılıf tabanlarının, köklerin ve yaprakların ksilem damarlarını sınırlayan parankim hücrelerinde ifade edilir.Yaprak kılıf tabanlarının floeminde ifade edilir.İlan.1İnduction : Köklerde tuz stresi ile.İlan.1 Alan Adı : HKT taşıyıcılarının, her biri bir potasyum kanalı benzeri seçicilik filtresi motifi içeren transmembran segmentleri ile çevrelenmiş 4 gözenek oluşturucu bölge içermesi önerilmektedir.Sekans benzerlikleri : TRKH potasyum taşıma ailesine aittir.HKT (TC 2.A. 38. 3) alt aile. [Sınıflandırmayı görüntüle].

Diğer karakterislikler